EnFrEsHT-RC630AV RECEIVERBasic ManualAdvanced Manual found herehttp://www.onkyo.com/manual/htrc630/adv/en.htmlEn
10Step 3: Playing BackListening modesSelect the desired mode by switching and listening actual sound in different modes. The selectable listening mode
11Step 3: Playing Back3Connecting and playing the Bluetooth-enabled deviceYou can wirelessly enjoy music files stored in a smartphone or other Bluetoo
12Step 3: Playing Back5Using Quick Setup menuIn the Quick Setup menu, you can set frequently used functions including input selection and volume adjus
13Step 3: Playing Back6Using the multi-zone functionYou can listen to the sound in a separate room by making the Zone connection (analog) between the
141 23 8 9 F G H J4 K567 IMLPRN O Q(European and Asian models)Front Panel1zON/STANDBY button: Turns the unit on or into standby mode.2BLUETOOTH indica
1514682 3 5 79FG HRear Panel1RI REMOTE CONTROL jack: An Onkyo product with RI jack can be connected and synchronized with this unit.2(/#06'00#L
16TroubleshootingBefore starting the procedureProblems may be solved by simply turning the power on/off or disconnecting/connecting the power cord, wh
17SpecificationsAmplifier SectionRated Output PowerAll channels: 60 watts minimum continuous power per channel, |QJONQCFUEJCPPGNUFTKXGPHTQO
18License and Trademark InformationManufactured under license from Dolby Laboratories. Dolby, Pro Logic and the double-D symbol are trademarks of Dolb
HT-RC630AV RECEIVERMode d'Emploi BaseFrMode d'Emploi Avancé trouvé icihttp://www.onkyo.com/manual/htrc630/adv/fr.html
2About the Basic ManualThe Basic Manual leads you through the fundamental steps to enjoy the AV Receiver from connections to TV, speaker system and pl
2A propos du Mode d'Emploi BaseLe Mode d'Emploi Base vous guide à travers les étapes fondamentales, afin d'utiliser l’ampli-tuner AV de
Etape 1 : Connexions31Connexion du téléviseur et des lecteursImportant : Le cordon d'alimentation doit être connecté uniquement lorsque toutes le
4Etape 1 : Connexions8QKTNCUGEVKQP|+PUVCNNCVKQP*&/+|FG|¥VCRG+PUVCNNCVKQP|r Pour lire des vidéos de 4K ou de 1080p, utilisez le
5Etape 1 : Connexions2Connexion des enceintesImportant : Le cordon d'alimentation doit être connecté uniquement lorsque toutes les autres connexi
6Etape 1 : Connexionsseuil du filtre mais une molette d'ajustement de la fréquence de seuil, tournez celle-ci sur sa fréquence maximale. Si votre
7Etape 2 : Installation1Mise sous tensionRaccordez le cordon d'alimentation à la prise. Appuyez surzON/STANDBY sur l'appareil principal ou b
8Etape 2 : InstallationDéplacez le curseur avec les boutons d/c et réglez la distance depuis chaque enceinte sur la position d'écoute. Appuyez su
Etape 3 : Ecouter91Lecture à partir du lecteur et le téléviseurz Pour contrôler l'unité : La télécommande peut être en mode à distance, ce qui pe
10Etape 3 : EcouterModes d'écouteSélectionnez le mode choisi en commutant et en écoutant le son en temps réel dans différents modes. Les modes d&
11Etape 3 : Ecouter3Connexion et lecture du son du périphérique compatible BluetoothVous pouvez profiter sans fil des fichiers musicaux stockés dans v
Step 1: Connections31Connecting the TV and playersImportant: The power cord must be connected only after all other connections are completed.HDMI Cabl
12Etape 3 : Ecouter5Utilisation du menu de réglage rapideDans le menu de réglage rapide, vous pouvez paramétrer les fonctions les plus souvent utilisé
13Etape 3 : Ecouter6Utilisation de la fonction multi-zoneVous pouvez écoutez de la musique dans une pièce séparée en créant la connexion (analogique)
141 23 8 9 F G H J4 K567 IMLPRN O Q(Modèles européen) Panneau frontal1BoutonzON/STANDBY : Permet la mise en marche ou veille de l'appareil.2Indic
1514682 3 5 79FG HPanneau arrière1Prise RI REMOTE CONTROL : Un produit Onkyo avec une prise RI peut être connecté et synchronisé avec cet appareil.22T
16DépannageAvant de démarrer la procédureLes problèmes peuvent être résolus simplement en allumant et en coupant l'alimentation, ou en débranchan
17SpécificationsPartie de l'AmplificateurPuissance de sortie nominaleToutes les chaînes : 60 watts minimum de puissance en continu par chaîne, 8
Fabriqué sous licence de Dolby Laboratories. Dolby, Pro Logic et le symbole double-D sont des marques déposées de Dolby Laboratories.Pour les brevets
Manual BásicoEsAquí encontrará el Manual Avanzadohttp://www.onkyo.com/manual/htrc630/adv/es.htmlHT-RC630AV RECEIVER
2Acerca del Manual Básico'N/CPWCN$½UKEQNGIWÉCCVTCXÅUFGNQURCUQUfundamentales para disfrutar el Receptor de AV desde las conexiones a la
Paso 1: Conexiones31Conexión de la TV o los reproductoresImportante:'NECDNGFGCNKOGPVCEKÏPFGDGEQPGEVCTUGUÏNQdespués de que todas las otras
4Step 1: Connectionssection 3 "HDMI Setup" of "Step 2: Setting Up".r To play 4K or 1080p video, use the high speed HDMI cable.Con
4Paso 1: Conexiones%QPUWNVGNCUGEEKÏPp%QPHKIWTCEKÏP*&/+qFGNp2CUQ%QPHKIWTCEKÏPqr Para reproducir vídeo de 4K o 1080p, use un cable HDM
5Paso 1: Conexiones2Conexión de altavocesImportante'NECDNGFGCNKOGPVCEKÏPFGDGEQPGEVCTUGUÏNQFGURWÅUFGSWGVQFCUNCUQVTCUEQPGZKQPGUUGJ
6Paso 1: Conexionesen DIRECT. Si el subwoofer no tiene un interruptor de UGNGEEKÏPFGHKNVTQFGEQTVGRGTQVKGPGWPFKCNFGCLWUVGFGHTGEWGPEKCFGEQ
7Paso 2: Configuración1Mise sous tensionRaccordez le cordon d'alimentation à la prise. Appuyez surzON/STANDBY sur l'appareil principal ou bi
8Paso 2: ConfiguraciónMueva el cursor con los botones d/c y ajuste la distancia FGECFCCNVCXQ\CNCRQUKEKÏPFGGUEWEJC2WNUG*1/'RCTCIWCTFCT
Paso 3: Reproducción91Reproducción del reproductor y la TVz Para controlar la unidad: El mando a distancia podría estar en el modo remoto, el cual per
10Paso 3: ReproducciónModos de audiciónSeleccione el modo deseado cambiando y escuchando sonido TGCNGPFKHGTGPVGUOQFQU.QUOQFQUFGCWFKEKÏPUGNGEE
11Paso 3: Reproducción3Conexión y reproducción del dispositivo con BluetoothPuede disfrutar de archivos de música almacenados en un teléfono inteligen
12Paso 3: Reproducción5Uso del menú de Ajuste rápido'PGNOGPÖ#LWUVGT½RKFQRWGFGEQPHKIWTCTNCUHWPEKQPGUHTGEWGPVGOGPVGWVKNK\CFCUKPENW[GPFQ
13Paso 3: Reproducción6Para desactivar la función multizona2QFT½GUEWEJCTGNUQPKFQGPQVTCJCDKVCEKÏPTGCNK\CPFQNCEQPGZKÏPFG\QPCCPCNÏIKEQGPVT
5Step 1: Connections2Connecting speakersImportant: The power cord must be connected only after all other connections are completed.45123612Front speak
141 23 8 9 F G H J4 K567 IMLPRN O Q(Modelos europeos) Panel Frontal1BotónzON/STANDBY: Enciende la unidad o la pone en modo de espera.2Indicador BLUETO
1514682 3 5 79FG HPanel Trasero1Conexión RI REMOTE CONTROL: Un producto 1PM[QEQPWPCEQPGZKÏP4+RWGFGUGTEQPGEVCFQ[sincronizado con esta unidad.2
Resolución de Problemas16Antes de iniciar el procedimientoEl problema puede solucionarse simplemente GPEGPFKGPFQ[CRCICPFQNCCNKOGPVCEKÏPQFGUEQPGE
17EspecificacionesSección del AmplificadorPotencia de Salida NominalTodos los canales: 60 vatios mínimo de potencia continua por canal, cargas de 8 oh
Información sobre licencias y marcas comerciales18Fabricado bajo licencia de los laboratorios Dolby. Dolby, Pro Logic y el símbolo de la doble D son m
* 2 9 4 0 1 8 0 5 *D1405-0SN 29401805(C) Copyright 2014 Onkyo Corporation Japan. All rights reserved.Kitahama Chuo Bldg, 2-2-22 Kitaha
6Step 1: Connectionsmaximum frequency. If your subwoofer does not have built-in power amplifier, you can connect a power amplifier between the unit an
7Step 2: Setting Up1Turning the power onConnect the power cord to the outlet. Press zON/STANDBY on the main unit or zRECEIVER on the remote controller
8Step 2: Setting UpMove the cursor with d/c buttons and set the distance from each speaker to the listening position. Press HOME to save the changed s
9Step 3: Playing Back1Playing the player and TVz To control the unit: The remote controller may be in the remote mode that enables control of other de
Kommentare zu diesen Handbüchern